Ваш IP:
216.73.216.22
Введите имя домена в поле ввода и нажмите Проверить.
Создан: (7 лет 11 месяцев назад)
IP-адрес: 91.242.200.197
Почта: norsknettskole-no.mail.protection.outlook.com.
Место: Европа / Норвегия
% By looking up information in the domain registration directory
% service, you confirm that you accept the terms and conditions of the
% service:
% https://www.norid.no/en/domeneoppslag/vilkar/
%
% Norid AS holds the copyright to the lookup service, content,
% layout and the underlying collections of information used in the
% service (cf. the Act on Intellectual Property of May 2, 1961, No.
% 2). Any commercial use of information from the service, including
% targeted marketing, is prohibited. Using information from the domain
% registration directory service in violation of the terms and
% conditions may result in legal prosecution.
%
% The whois service at port 43 is intended to contribute to resolving
% technical problems where individual domains threaten the
% functionality, security and stability of other domains or the
% internet as an infrastructure. It does not give any information
% about who the holder of a domain is. To find information about a
% domain holder, please visit our website:
% https://www.norid.no/en/domeneoppslag/
Domain Information
NORID Handle...............: NOR36905D-NORID
Domain Name................: norsknettskole.no
Registrar Handle...........: REG921-NORID
Tech-c Handle..............: NM17R-NORID
Name Server Handle.........: NSAN286H-NORID
Name Server Handle.........: NSAN287H-NORID
Name Server Handle.........: NSAN288H-NORID
Name Server Handle.........: NSAN289H-NORID
Additional information:
Created: 2018-02-08
Last updated: 2025-02-08
norsknettskole.no has address 91.242.200.197
norsknettskole.no mail is handled by 10 norsknettskole-no.mail.protection.outlook.com.
;; global options: +cmd
;; Got answer:
;; ->>HEADER<<- opcode: QUERY, status: NOTIMP, id: 22989
;; flags: qr rd ra; QUERY: 1, ANSWER: 0, AUTHORITY: 0, ADDITIONAL: 0
;; WARNING: EDNS query returned status NOTIMP - retry with '+noedns'
;; QUESTION SECTION:
;norsknettskole.no. IN ANY
;; Query time: 0 msec
;; SERVER: 1.1.1.1#53(1.1.1.1) (TCP)
;; WHEN: Tue Jan 13 21:41:10 MSK 2026
;; MSG SIZE rcvd: 35
;; Got answer:
;; ->>HEADER<<- opcode: QUERY, status: NOERROR, id: 55897
;; flags: qr rd ra; QUERY: 1, ANSWER: 0, AUTHORITY: 1, ADDITIONAL: 1
;; OPT PSEUDOSECTION:
; EDNS: version: 0, flags:; udp: 1232
;; QUESTION SECTION:
;norsknettskole.no. IN SRV
;; AUTHORITY SECTION:
norsknettskole.no. 300 IN SOA ns1.anycast.no. hostmaster.nexthop.no. 2017083101 7200 600 1209600 300
;; Query time: 28 msec
;; SERVER: 1.1.1.1#53(1.1.1.1) (UDP)
;; WHEN: Tue Jan 13 21:41:10 MSK 2026
;; MSG SIZE rcvd: 113
Информация получена за 6103 мс.
216.73.216.22 akkukellari.fi zoozoom.lv etec.sk recordease.biz pailkettle3.bravejournal.net libinhao.cn top-reality.sk fancybox.qa zzb.bz cctry.com micespring0.bravejournal.net pasmm.com veera-kaihdin.fi residehere.com www.space.sosot.net rintech.ru dokuwiki.org Ugg.Msk.ru neulsok.com listabella.dk jenteeskorte.rf.gd vittighed.dk artificialtoughness.com.de spitz.dk glaceau.fi idiving.de thegoldenlion.dk lender.dk feministischepsychiatriekritik.de norsknettskole.no